SMD1B

Small nuclear ribonucleoprotein SmD1b

116 amino acids

Involved in splicing regulation. Facilitates post-transcriptional gene silencing (PTGS) by limiting the degradation of transgene aberrant RNAs by the RNA quality control (RQC) machinery, thus favoring their entry into cytoplasmic siRNA bodies where they can trigger PTGS. Does not participate in the production of small RNAs.

Belongs to the snRNP core protein family.

12.75 kDa

MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDVSMNTHLKAVKLTLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEDTPRIKPKKPTAGKIPAGRGRGRGRGRGRGRGGR