ska1

Spindle and kinetochore-associated protein 1

258 amino acids

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.

Belongs to the SKA1 family.

29.669 kDa

MNHCELEEVTQHINNKISMIKRLLELRAVAKDPDKRGTLLKIGQEVSAINELLDRFEKYVGKQRDLLKHLKDLEGFFQEDEQDAYHLKNNTPPHMPKRGQQAAPQGGGQVAVQSRQTDAPAAPQEQGPPRKTQRNQIKEMEFITVPEFDSIPPYMKGRVTYDQLNAAVQSINTAVTSKYKILHQPVKTLNNVSRSLQQRFKDQETKDTKGHFFVVEQDIKEFAQLKVDKRFVGMLNMLRHCQRLKEVRGGGLTRFILL

SKA1

Spindle and kinetochore-associated protein 1

255 amino acids

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:17093495, PubMed:19289083, PubMed:23085020). Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint (PubMed:17093495). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020). In the complex, it mediates the interaction with microtubules (PubMed:19289083, PubMed:23085020).

Belongs to the SKA1 family.

29.484 kDa

MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT

SKA1

Spindle and kinetochore-associated protein 1

254 amino acids

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.

Belongs to the SKA1 family.

29.412 kDa

MASDLEQLCAHINEKIGNIKRTLSLRNCGQEPTLKTILNKIGDEIIVVNELLNKLELEIQYQEQTNSSLKELFESLEEDYKDVEHLKENIPPHLPQVTVTQNFVNGSDLDPEEPVKVEEPAPTKKPPKEQRSIKEMPFITSDEFNGIPAYMKSRLTYCHINDVIKEINKAVVSKYKILHQPKKSMSSVARNLYHRFIDEETKETKGHYFVVEADIKEFTTLKVDKRFHGILNILRHCRRLSEVRGKGLTRYVIT

Ska1

Spindle and kinetochore-associated protein 1

254 amino acids

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.

Belongs to the SKA1 family.

29.445 kDa

MDSELEDLCSYVNEKIGNIKKILSIRNLGQDPALKTTLSKIGDEIIAVNELLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTATQSLVHKPEPDPKESDKAEEPGLPKKPPREQRVIKEMQFITMDEFSDVPAYMKSRLTYCQINDIIKEINKAVVSKYKIMHQPKASMSSVKRNLYQRFINEETKDTKGHHFIVEADIKEFTALKVDKRFYVIMHILRHCHRLSEVRGGGLTRYVIT

Ska1

Spindle and kinetochore-associated protein 1

254 amino acids

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.

Belongs to the SKA1 family.

29.421 kDa

MASDLEQLCSYVNEKIENIKKILSLRKLGQDPTLKTTLSKIGDEIITVNELLNQFELEIQYQEQTNSSLKELCKSLEEEFKDVEHLKEHIPSHLPQVTVTQSSTHKPDLDPKESVKAEEPVLPKKPPKEQRVIKEMHFITTDEFSGVPAYMKSRLTYCQINDVIKEINKAVVSKYKIIHQPKASMSSVKRNLYQRFINEETKDTKGRHFIVEADIKEFTTLKVDKKFHVIMNILRHCQRLSEVRGGGLTRYVIT

ska1

Spindle and kinetochore-associated protein 1

252 amino acids

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.

Belongs to the SKA1 family.

28.952 kDa

MDPGDLDELCSHVNSKISLIKKTLQLRNIGQDPSLNSVLSKIAFEMHSLYNLLNNLETEVQRQETIANSLRELQATVERDFTEASHLKENIPPHLPKRTQSSSSAPDEAPEMVVKVAAPEPAKKPSKEKPIKEMELITVHEFGTVPAYMKNRLTYEQINNIIEELNKAVVGKYKILHQPLKSLSNQARKQLSRYKEEETKDTKGQFFIVDQDIKDFTQVKVDKRFHGMLSILRHCHRLREIRGKGLVRYIIC