About Services Proteins Contact

SIR2rp1

Gene
SIR2rp1
Protein
NAD-dependent protein deacetylase SIR2rp1
Organism
Leishmania major
Length
373 amino acids
Function
NAD-dependent deacetylase, which probably acts as a regulator of gene expression believed to help form modified chromatin structures on the genes it regulates.
Similarity
Belongs to the sirtuin family. Class I subfamily.
Mass
40.554 kDa
Sequence
MTGSPRAPHQEHALGEPTVEGLARYIREKDVRRILVLVGAGASVAAGIPDFRSSDTGIYAKLGKYNLDDPTDAFSLTLLREKPEIFYSIARELNLWPGHFQPTAVHHFIRLLQDEGRLLRCCTQNIDGLEKAAGVSPELLVEAHGSFAAAACIECHTPFSIEQNYLEAMSGTVSRCSTCGGIVKPNVVFFGENLPDAFFDALHHDAPIAELVIIIGTSMQVHPFALLPCVVPKSIPRVLMNRERVGGLLFRFPDDPLDTIHDDAVAKEGRSSSSQSRSPSASARREEGGTEDGSSSPNEEVEDASTSSSSDGYGQYGDYYAHPDVCRDVFFRGDCQENVLKLAECLGLREALAKRMRFSGAAPATARKTSNET

Gene
SIR2rp1
Protein
NAD-dependent protein deacetylase SIR2rp1
Organism
Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
Length
351 amino acids
Function
NAD-dependent protein deacetylase, which is involved in repression of RNA polymerase I-mediated expression immediately adjacent to telomeres. It is however not involved in antigenic variation and subtelomeric variant surface glycoprotein (VSG) gene silencing. Plays a role in DNA damage response. Also has ADP-ribosylation activity in vitro.
Similarity
Belongs to the sirtuin family. Class I subfamily.
Mass
38.575 kDa
Sequence
MTEPKLATTHVVGEPTFEGLARFIERNNITKIFVMVGAGISVAAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYNILMDMDLWPGKYCPTTVHHFISLLAKKGMLLCCCTQNIDGLERACGIPESLLVEAHGSFSSASCVDCHAKYDINMARAETRAGKVPHCNQCGGIVKPDVVFFGENLPEAFFNVAGLIEETELLLILGTSLQVHPFADLALMVPSDVPRVLFNLERVGGRMFRFPTDRTPNFRASSYRLSTGNGNGSKISSGDSSNSSSVDGYDQFTLAENDETGVLRDIFFPGDCQVSVRSFAQALGFGEQLDASVREGREIFERTRRREKVVEG