About Services Proteins Contact

SH3BGR

Gene
SH3BGR
Protein
SH3 domain-binding glutamic acid-rich protein
Organism
Homo sapiens
Length
239 amino acids
Similarity
Belongs to the SH3BGR family.
Mass
26.086 kDa
Sequence
MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFPTVEMVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETEEIAMEGAEGEAEEEEETAEGEEPGEDEDS

Gene
Sh3bgr
Protein
SH3 domain-binding glutamic acid-rich protein
Organism
Mus musculus
Length
214 amino acids
Similarity
Belongs to the SH3BGR family.
Mass
23.102 kDa
Sequence
MVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRKWMRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPGSKVTKSEEASSLPNGDVAGEAEGAAEGTEKAEKSGENEAQKEDSEDTGELSESQEKKEEEGEDGEEGEEGEEREEGGEGETTGETEEAPEEGAGGEAEEEEPEEEAGEGEDS