SH2D2A

SH2 domain-containing protein 2A

389 amino acids

Could be a T-cell-specific adapter protein involved in the control of T-cell activation. May play a role in the CD4-p56-LCK-dependent signal transduction pathway. Could also play an important role in normal and pathological angiogenesis. Could be an adapter protein that facilitates and regulates interaction of KDR with effector proteins important to endothelial cell survival and proliferation.

42.934 kDa

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAEEVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ

Sh2d2a

SH2 domain-containing protein 2A

374 amino acids

Could be a T-cell-specific adapter protein involved in the control of T-cell activation. May play a role in p56-LCK-mediated T-cell signaling. Could be involved in the regulation of responses to T-cell activation stimuli, specifically proliferation and lymphokine production. Interactions with ITK and TXK may provide important biochemical links of these two important kinases with other components in the T-cell activation machinery.

40.953 kDa

MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSMQVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQAHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFLLAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRADSDSGSKRQDPDTQLSLLLQQGQAQASGHTEKVWASQQKATSQASRPRPPIPAKPQLPPEVYTSPASRLHQAPPINPIYQEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHPILRKCWSRPISRGQVREVQGKISSRSRAERGSPS