About Services Proteins Contact

SH2477

Gene
SH2477
Protein
Putative TrmH family tRNA/rRNA methyltransferase
Organism
Staphylococcus haemolyticus (strain JCSC1435)
Length
249 amino acids
Similarity
Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.
Mass
27.236 kDa
Sequence
MEDIVIVGRHAVKEAIVSGHTINKIWIQEGIRKQQINDILQNAKEQKLIVQTVPKSKLDNLANAPHQGVAALIAPYEYADFDQFIQSQKDKEGLSTVVILDGLEDPHNLGSILRTADASGVDGVIIPKRRSVALTQTVAKASTGAIQHVPVMRVTNLAKTIDELKEHGYWVAGAEADNATDYRDMAADMPLAIVIGSEGQGMSRLVKDKCDFYIKIPMVGHVNSLNASVAASLMMYEVYRKRHQVGDNA