About Services Proteins Contact

SH2119

Gene
SH2119
Protein
Epimerase family protein SH2119
Organism
Staphylococcus haemolyticus (strain JCSC1435)
Length
299 amino acids
Similarity
Belongs to the NAD(P)-dependent epimerase/dehydratase family. SDR39U1 subfamily.
Mass
34.188 kDa
Sequence
MKQFLITGGTGMVGSQLVNKLKNRDVHITILTRSDKQSDDPKISYVNWSKDGWMSQVPDIDVVVNLAGATLNKRWTPSYKQLIMTSRIQSTQSLVDLFSQREHKPEVLFNASAMGYYPPSLYHTYTEKYQTHPFDFLSDVVYQWERFAKRFESFGTRVVLGRFSMILSNDGGALQTMKLPYKFFVGGKLGSGFQWYSWIHINDLVRAILFTIDNPNAKGPFNMAAPIAERQNLFGYTLARVMHRPHETWVPSFLMRLALGEMSTVVLDTQKVLPNKLDALGFTFNYSNLKIAFEDLIDA