About Services Proteins Contact

SH1739

Gene
SH1739
Protein
Uncharacterized N-acetyltransferase SH1739
Organism
Staphylococcus haemolyticus (strain JCSC1435)
Length
147 amino acids
Mass
17.228 kDa
Sequence
MSEVKHLEINYKTDELFEAFREFGNKDLYMVEELQGQMIDASSESPFYGIFHGENLVARMALLKKGDVEEIYFPEFDDYLLLWKLEVLDNYKNKGYGQSLIDYAKSYNMPIKAIARQNSKEFLMNQDFEDVHAKNPEGHDVLVWAPK