About Services Proteins Contact

SGO_1537

Gene
SGO_1537
Protein
Initiation-control protein YabA
Organism
Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Length
107 amino acids
Function
Involved in initiation control of chromosome replication.
Similarity
Belongs to the YabA family.
Mass
12.461 kDa
Sequence
MDKREIFDALDDFSQNLMLTLAEVEAIKKNLKSVIEENTVLRLENDKLRERLGEVEKTGPSKGGGQGRENLERIYLDGFHICTDFYGQRRDNDEEECAFCNELLFRE