About Services Proteins Contact

SG0690

Gene
SG0690
Protein
Nucleoid-associated protein SG0690
Organism
Sodalis glossinidius (strain morsitans)
Length
109 amino acids
Function
Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
Similarity
Belongs to the YbaB/EbfC family.
Mass
11.973 kDa
Sequence
MFGKGGMGNLMKQAQQMQEKMQRMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEVDPSLLEDDKDMLEDLIAAAFNDAARRIAETQKEKMAAVSSGMQLPPGFKMPF