SEN54

tRNA-splicing endonuclease subunit SEN54

467 amino acids

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. May be required to embody the molecular ruler of the complex.

Belongs to the SEN54 family.

54.649 kDa

MQFAGKKTDQVTTSNPGFEEEEEEEEELQQDWSQLASLVSKNAALSLPKRGEKDYEPDGTNLQDLLLYNASKAMFDTISDSIRGTTVKSEVRGYYVPHKHQAVLLKPKGSFMQTMGRADSTGELWLDFHEFVYLAERGTILPYYRLEAGSNKSSKHETEILLSMEDLYSLFSSQQEMDQYFVFAHLKRLGFILKPSNQEAAVKTSFFPLKKQRSNLQAITWRLLSLFKIQELSLFSGFFYSKWNFFFRKYTTSPQLYQGLNRLVRSVAVPKNKKELLDAQSDREFQKVKDIPLTFKVWKPHSNFKKRDPGLPDFQVFVYNKNDDLQHFPTYKELRSMFSSLDYKFEFLSEIEDDDDWETNSYVEDIPRKEYIHKRSAKSQTEKSESSMKASFQKKTAQSSTKKKRKAYPPHIQQNRRLKTGYRSFIIAIMDNGLISFVKMSEADFGSESVWYTPNTQKKVDQRWKKH

SEN54

tRNA-splicing endonuclease subunit SEN54

455 amino acids

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. May be required to embody the molecular ruler of the complex (By similarity).

Belongs to the SEN54 family.

52.261 kDa

MTEAEELSVALGLHDSDAEEDALAQDWSEMAKLVKKANQHALPRRGEKDYEPDGTDAQALLLHTAKETMFGTLLNSVRGSTVKTLIKAYWEEEQRMARIPNARGSFTNTMGKVDKHGQCWLQLHEFVYLVERGTVSPYLALTVGDEKSNHEDVLLSVQDVYALFSSTEELDEFLVYAHLKRLGFIVVSTDNPPAHVTSFYPPLSQKSSASSNWFCHIHSWLKTPQNLFHVPLYHPLHFLLHRYTSSPQLYEELSQHIPFKKVPHDINELREERNNGILNPNVKQWKIAFNVWKPKSSFKKKTPGLPDFQVVVYNKDNAGQQFPTYDEFRSIFHRLDYRFDFLNELDVDDSAWDDYTYTDGMPTREFMQRNKIAPSQPHSGGDSRKKKARTYPQHIAQIRRLKSGFKSFILSVIDDGLVSFVRIAESDFGSSNIWYTPPSQTGTTNNRTRSDKVDV

sen54

Probable tRNA-splicing endonuclease subunit sen54

384 amino acids

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. May be required to embody the molecular ruler of the complex (By similarity).

Belongs to the SEN54 family.

44.151 kDa

MDAQDEDNPFTNLETTVDVTEEIQDWRFLSNVEKDQGTYTIPKRGQKDFEPDGTNKQHSALDLSRKAMFDALSVERLISAKHAIIATWNAQNGMSCVEKAHGPLFKTMGTADSQNRMWLLPEETLYLVERGSMECWSEEGLPMSLQAVYSASIPLCGSLENYLVYAHLRRCGFSVIRSNLVPVKEDEYRCDSKIMNFKDLLFLGLGKASQILQTFNFRKLAFPFSKRRRQSILLHDTFYTYEEVYHDLQIVRGYVPIACNLITSSDSLFQITFHAYKPSASFKKSALSEPDFRICVVSSQDTLLPTIFEIDALFSSTPLRQNMPQHMFQRLKEGYRNIIIAIVDYGVISYIRLSDVCFEEKVYTDFSKKGSKRKRVSKKFQQLV