sen2

Probable tRNA-splicing endonuclease subunit sen2

380 amino acids

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage (By similarity).

Belongs to the tRNA-intron endonuclease family.

44.608 kDa

MSKNHEVYKDALPISLAYPLPPIILTNPLTWIPYIYRYLFRKTPRQVQWQCQLHESDLSCVVTDSEAIKKFWTSGFFGKGNLSRSEPTWHTRTKRSLGLLGFDEDLVAEEVTARRRFQRKQFKAQRAYRENRARERQLLLENGKPIPASLEEDAELPEYLTKSLKDFSRVSENPYHITSVPNVEHLQLTFPEAFFLASLGVLRINYENPNFELLPILKLFANIVANSVALTHDYSLQQSHEDPIIEPDNKFLTELAAYFYFRQQGWVVKNGTKFSVDFLLYKKGPVFSHAEFAILLIPCVGNKQKYNMQWHEVHCLNRVIAQVKKSLILCYVQCPSIEDFNKIWKNQASMNEWDWAESVLRQYLIRCVTLRRWVPSRNRD

SEN2

tRNA-splicing endonuclease subunit SEN2

377 amino acids

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage.

Belongs to the tRNA-intron endonuclease family.

44.109 kDa

MSKGRVNQKRYKYPLPIHPVDDLPELILHNPLSWLYWAYRYYKSTNALNDKVHVDFIGDTTLHITVQDDKQMLYLWNNGFFGTGQFSRSEPTWKARTEARLGLNDTPLHNRGGTKSNTETEMTLEKVTQQRRLQRLEFKKERAKLERELLELRKKGGHIDEENILLEKQRESLRKFKLKQTEDVGIVAQQQDISESNLRDEDNNLLDENGDLLPLESLELMPVEAMFLTFALPVLDISPACLAGKLFQFDAKYKDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEFCVMGLDHDVSKDYTWYSSIARVVGGAKKTFVLCYVERLISEQEAIALWKSNNFTKLFNSFQVGEVLYKRWVPGRNRD

SEN2

tRNA-splicing endonuclease subunit SEN2

356 amino acids

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage (By similarity).

Belongs to the tRNA-intron endonuclease family.

41.096 kDa

MAKRVAGSKRYVHPLPIEPVVLPPLIAHNPLSWVYWVLAYVTSSNQLPRKIPLEVGADGRYTVTGREQMQYLWEHGFFGTGQLSRSEPTWQARTVDRLQLDTEGIAGHKLEQVTQLRRKQRLEFKRERASFERKRLELRRQGVLESEILEQERLWLKQLRDRELQWEASTGDPSPVRAEDAEIIAEDGASVLPIEKLELMPVEALFLTLALPVLHADAPAILARTLGPQPALPQIERLCRLYAAYHHYRSHGWCVRSGIKFGCDFLLYRRGPPFHHAEFSVMVLAPDERHDYTWYSTVARVVGGAQKTLVLAYVARRAAADQLAALWHARRYMEAFALFEVHELVYRRWLPGKNRE

SEN2

tRNA-splicing endonuclease subunit Sen2-2

250 amino acids

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Probably carries the active site for 5'-splice site cleavage (By similarity).

Belongs to the tRNA-intron endonuclease family.

28.519 kDa

MAPRWKWKGAEAKALAEPISKSVSELQLSLAETESSGTLSSCNVLLAVEPEQAELLDRCCFGRLVLSAEKIKKWIQLSFEEAFFLHYNLKCIKISLQGRCLENEVDTWLYMKSKRPNFPMFFKAYSHLRSKNWVLRSGLQYGVDFVAYRHHPSLVHSEYSVLVQSGDSDRLRVWSDIHCAVRLSGSVAKTLLTLYVNGNFKGEDVNLLVCLENFTVEEQTISRWSPELSREDQSTNSKQHVPNVSNLNTL