About Services Proteins Contact

SDH7A

Gene
SDH7A
Protein
Succinate dehydrogenase subunit 7A, mitochondrial
Organism
Arabidopsis thaliana
Length
93 amino acids
Mass
10.298 kDa
Sequence
MAFLLNTSISSHLRSSSQKTDGALAQSRRGFHVELGAREKALLAEDASLRRFKSHKKGVHRLKRIGDVLTVVVVAGCCYEIYARVMRKEAQAA