About Services Proteins Contact

SCYGR6

Gene
SCYGR6
Protein
Small cysteine and glycine repeat-containing protein 6
Organism
Homo sapiens
Length
105 amino acids
Function
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Similarity
Belongs to the KRTAP type 28 family.
Mass
9.896 kDa
Sequence
MGCCGCGGCGGGCGGCGGGCSGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCHSCGCGCGCGKGCCQQKGCCQQKGCCKKQCCC