About Services Proteins Contact

SCRL22

Gene
SCRL22
Protein
Putative defensin-like protein 233
Organism
Arabidopsis thaliana
Length
98 amino acids
Similarity
Belongs to the DEFL family.
Mass
11.179 kDa
Sequence
MGMWCTTLFMVSCVSICLILSHVQEVEAGAPPQDCWNLVTFPAKCGIHGKKKCFKEMESKYQQRFLQCTCKNLKPEPKSPKDEHDCTCQRANPYECNS