SCP

Small capsomere-interacting protein

252 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

24.554 kDa

MAHARPKLPRINLRLDAEYPNDPRVQQLHLQILNNPNYANNVRAPLSYLVFLTAQEMYEVFVRQARGVNKKRSGGPEKPILPANPGAGPQNAPGCGGGGSGSGGSGPPGGSAPQIQPPNNGVPSNQVSSNSGSAAGSGSGSGASSNSGAGSGAGAGSSACPSSGAGSGAGAGSSAGSNVQAPPAPPPLPQVPMVPGVVNGQEMYLPLGPVNGLPQQLGTAGSDNSGGQASSPGSQNPPTKPVAPRGKLGKGR

SCP

Small capsomere-interacting protein

235 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

24.417 kDa

MTQPASSRVVFDPSNPTTFSVEAIAAYTPVALIRLLNASGPLQPGHRVDIADARSIYTVGAAASAARARANHNANTIRRTAMFAETDPMTWLRPTVGLKRTFNPRIIRPQPPNPSMSLGISGPTILPQKTQSADQSALQQPAALAFSGSSPQHPPPQTTSASVGQQQHVVSGSSGQQPQQGAQSSTVQPTTGSPPAAQGVPQSTPPPTQNTPQGGKGQTLSHTGQSGNASRSRRV

SCP

Small capsomere-interacting protein

179 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

18.744 kDa

MPRDEMEACELGDGEGYQPLRLPRVQGKLEEINPIVAAEVAALERRDRSDADYEKVKMLYVIYLRVHEIYDDQARIRLGVRRKKHLGDLTASRGAGLRSFEALSSMIPLPPETGEFDTGGTSSSVRSASGASGGAASTAASGGSASAAASGASGGSASQSDVSSRSRSQQAPGTKGKKQ

SCP

Small capsomere-interacting protein

176 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

18.147 kDa

MARRLPKPTLQGRLEADFPDSPLLPKFQELNQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ

SCP

Small capsomere-interacting protein

170 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

18.569 kDa

MSNFKVRDPVIQERLDHDYAHHPLVARMNTLDQGNMSQAEYLVQKRHYLVFLIAHHYYEAYLRRMGGIQRRDHLQTLRDQKPRERADRVSAASAYDAGTFTVPSRPGPASGTTPGGQDSLGVSGSSITTLSSGPHSLSPASDILTTLSSTTETAAPAVADARKPPSGKKK

SCP

Small capsomere-interacting protein

141 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

15.246 kDa

MSTSSRQQSPAGGDGSTGGGSAAHCSGHAPVNALVEFLRTAPRTHTPEQLQAIARSSINDLSEALRALRTDLPKGDPVRGFLRANTTLALSLLNHAPRLREQLNIQPVAARLTGPQGFWSFGIRQRNRPQILRPPQLSRKK

SCP

Small capsomere-interacting protein

139 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

15.344 kDa

MHRLRVTDPVVQGKLEESDSTHELVKRLEILPQNNMTPEEYTLMKRNYLVFLIAQYNFDQYIETTHGIKRKKHIEGLKANLKPSALSADSASLSGLLSTSLTTPSLSSTPTSLTSMPGLSISGPSTTDTIDSKKKPKAK

SCP

Small cardioactive peptides

136 amino acids

The cardioactive peptides enhance the contractions of the auricle in vitro.

Belongs to the SCP family.

14.809 kDa

MEITLPRVSLSLAVLLVIVCSVDAQNYLAFPRMGRSGYLAFPRMGRSHFKSETSADVTGCCGVGIKNEFLIGQDGKEEIRSACGARADCCEGLKEVVDQKNDGVYFSMCVPDITFAQASSVRSSEVFNKLKSLLEK

SCP

Small capsomere-interacting protein

131 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

14.489 kDa

MSRASSQQASPTSQTFDPSDLSTYTLDVLHHYPLVDLLQQLNAIPNDLKIPDTYSKVEQAARINVLRAICVGFAEVRRHNDNRTLQRSTMFAVNDAASRIRPSIGLKRTFPTGIFSTTIHGSPSDDDISTS

SCP

Small capsomere-interacting protein

119 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

13.597 kDa

MAADKQQQQAPVAFNPADPPNIKAANFKDMLPVDVITILNQNIDELDYTKYTEDEISEGLKQLFMGTARTMVSLRQRHLKSLVRRSDMFAQNDASTWARPNIGLKRTFPPRFMQPISED

SCP

Small capsomere-interacting protein

119 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

13.597 kDa

MAADKQQQQAPVAFNPADPPNIKAANFKDMLPVDVITILNQNIDELDYTKYTEDEISEGLKQLFMGTARTMVSLRQRHLKSLVRRSDMFAQNDASTWARPNIGLKRTFPPRFMQPISED

SCP

Small capsomere-interacting protein

112 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly (By similarity). Interaction with host dynein light chains suggests a possible function in the retrogarde transport of incoming viral capsids.

Belongs to the herpesviridae small capsomere-interacting protein family.

12.096 kDa

MAVPQFHRPSTVTTDSVRALGMRGLVLATNNSQFIMDNNHPHPQGTQGAVREFLRGQAAALTDLGLAHANNTFTPQPMFAGDAPAAWLRPAFGLRRTYSPFVVREPSTPGTP

SCP

Small capsomere-interacting protein

112 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

12.134 kDa

MAAPQFHRPSTITADNVRALGMRGLVLATNNAQFIMDNSYPHPHGTQGAVREFLRGQAAALTDLGVTHANNTFAPQPMFAGDAAAEWLRPSFGLKRTYSPFVVRDPKTPSTP

SCP

Small capsomere-interacting protein

89 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

9.812 kDa

MTTIRGDDLSNQITQISGSSSKKEEEKKKQQMLTGVLGLQPTMANHPVLGVFLPKYAKQNGGNVDKTAFRLDLIRMLALHRLNTKTGSD

SCP

Small capsomere-interacting protein

88 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

9.741 kDa

MTTIRSDDLSNQITQISGSSKKEEEKKKQQMLTGVLGLQPNMASHPVLGVFLPKYAKQNGGNVDKTAFRLDLIRMLALHRLNTKTGSD

SCP

Small capsomere-interacting protein

75 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

8.481 kDa

MSNTAPGPTVANKRDEKHRHVVNVVLELPTEISEATHPVLATMLSKYTRMSSLFNDKCAFKLDLLRMVAVSRTRR

SCP

Small capsomere-interacting protein

75 amino acids

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Belongs to the herpesviridae small capsomere-interacting protein family.

8.495 kDa

MSNTAPGPTVANKRDEKHRHVVNVVLELPTEISEATHPVLATMLSKYTRMSSLFNDKCAFKLDLLRMIAVSRTRR