SAMS3

S-adenosylmethionine synthase 3

396 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate (By similarity). May be involved in the synthesis of betain in response to abiotic stress such as high salinity (PubMed:15695433).

Belongs to the AdoMet synthase family.

43.139 kDa

MAAAVDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTRRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKESFDFRPGMIAINLDLLKGGSRYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA

SAMS3

S-adenosylmethionine synthase 3

390 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

42.556 kDa

METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNEQIAQDLKEHVIKPVIPAQYLDDQTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVAEPLSVFVDTFKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAALGHLGRDDPDFTWETVKILKPKA