SAM2

S-adenosylmethionine synthase 2

396 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

43.189 kDa

MAAAADTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDAESKVACETCTKTNLVMVFGEITTKANVDYEKIVADTCREIGFVSPDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSRKDPTKVDRSGAYIARQAAKSIVASGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIHDREILKIVKENFDFRPGMIAIALDLKKGGNRYLKTAAYGHFGREDPDFTWEAAKTLKWEKPQA

SAM2

S-adenosylmethionine synthase 2

394 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

42.828 kDa

MAAETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRDIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEVGAGDQGIMFGYATDETPELMPLTHMLATKLGARLTEVRKNGTCAWLRPDGKTQVTIEYLNEGGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPGKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIIASGLARRCIVQISYAIGVPEPLSVFVDSYGTGKIPDREILKLVKENFDFRPGMISINLDLKKGGKRFIKTAAYGHFGRDDADFTWEVVKPLKFDKASA

SAM2

S-adenosylmethionine synthase 2

394 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

42.901 kDa

MAAETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYLNDAGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPDKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGNRFIKTAAYGHFGREDPDFTWEVVKPLKYEKASS

SAM2

S-adenosylmethionine synthase 2

393 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

43.255 kDa

METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATIDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIARDLKEHVIKPIIPEKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKETFDFRPGMMTINLDLKRGGNGRFQKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA

SAM2

S-adenosylmethionine synthase 2

393 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

43.082 kDa

METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANIDYEKIVRDTCREIGFVSPDVGLDADNCRVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCSWLRPDGKTQVTVEYHNDNGAMVPLRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILNIVKENFDFRPGMISINLDLLRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPEA

SAM2

S-adenosylmethionine synthase 2

390 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

42.607 kDa

MESFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFTSPDVGLDADHCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNNTCPWLRPDGKTQVTVEYRNEGGAMVPVRVHTVLISTQHDETVTNEQIAKDLKEHVIKPVIPAQYMDDDTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYVVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAAYGHFGRDDADLTWETVKILKPKA

SAM2

S-adenosylmethionine synthase 2

390 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

42.593 kDa

METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTSMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNDNGAMIPLRVHTILISTQHDETVTNDQIAQDLKEHVIKPVVPAEYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPGKDVLTLIKENFDFRPGMMSINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLNPQA

SAM2

S-adenosylmethionine synthase 2

384 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

42.256 kDa

MSKSKTFLFTSESVGEGHPDKICDQVSDAILDACLEQDPFSKVACETAAKTGMIMVFGEITTKARLDYQQIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGLHYEKSLEDLGAGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLPWLRPDTKTQVTVEYEDDNGRWVPKRIDTVVISAQHADEISTADLRTQLQKDIVEKVIPKDMLDENTKYFIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASSVGGGAFSGKDYSKVDRSAAYAARWVAKSLVAAGLCKRVQVQFSYAIGIAEPLSLHVDTYGTATKSDDEIIEIIKKNFDLRPGVLVKELDLARPIYLPTASYGHFTNQEYSWEKPKKLEF