About Services Proteins Contact

S1FA3

Gene
S1FA3
Protein
DNA-binding protein S1FA3
Organism
Arabidopsis thaliana
Length
73 amino acids
Function
DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter.
Similarity
Belongs to the S1FA transcription factor family.
Mass
8.071 kDa
Sequence
MAAEFDGKIESKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEKMKQGVQVPGE