Rz1

Spanin, outer lipoprotein subunit

62 amino acids

Component of the spanin complex that disrupts the host outer membrane and participates in cell lysis during virus exit (Probable). The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans (By similarity). Host outer membrane disruption is due to local fusion between the inner and outer membrane performed by the spanin complex (By similarity).

Belongs to the Lambdavirus o-spanin family.

6.955 kDa

MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPRLPPAWIMQPPPDFTWQTPLNGIISPSERG

Rz1

Probable spanin, outer lipoprotein subunit

61 amino acids

Component of the spanin complex that disrupts the host outer membrane and participates in cell lysis during virus exit. The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. Host outer membrane disruption is possibly due to local fusion between the inner and outer membrane performed by the spanin complex (By similarity).

Belongs to the caudovirales o-spanin family.

6.617 kDa

MLTRLSKLSALMFLLGVSACKSPPPVQSQRPEPAAWAMEKAQDLQQMLNSIITVSEVESTG

Rz1

Spanin, outer membrane subunit

61 amino acids

Component of the spanin complex that disrupts the host outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans (By similarity).

Belongs to the lambdalikevirus o-spanin family.

6.509 kDa

MRELKMKLCVLMLPLVVSACGSTPPAPVPCVKPPAPPAWIMQPAPDWQTPLNGIISSSERG

Rz1

Spanin, outer lipoprotein subunit

60 amino acids

Component of the spanin complex that disrupts the host outer membrane and participates in cell lysis during virus exit (PubMed:22904283, PubMed:23387988, PubMed:25870259). The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans (PubMed:25870259). Host outer membrane disruption due to local fusion between the inner and outer membrane performed by the spanin complex (PubMed:25870259).

Belongs to the Lambdavirus o-spanin family.

6.588 kDa

MLKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSERG