About Services Proteins Contact

Rleg2_2653

Gene
Rleg2_2653
Protein
UPF0303 protein Rleg2_2653
Organism
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Length
165 amino acids
Similarity
Belongs to the UPF0303 family.
Mass
17.942 kDa
Sequence
MTIEQDLSRIAEQEKALSFDAFDLTTAWQLGKLLQELATERGLGIAIDVTLHSMPVFYAALPGVTPDNVNWVRRKRNMVLRYFRSSYASGLKLSKDGKTVEDNGLSGADYAPHGGSFPINVKGTGCIGAVTVSGLPQRDDHNLAVEALALMLAKDLDTLRLDPPL