Rnaseh2a

Ribonuclease H2 subunit A

301 amino acids

Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.

Belongs to the RNase HII family. Eukaryotic subfamily.

33.513 kDa

MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAPHRYFQERGLEAASSL

Rnaseh2a

Ribonuclease H2 subunit A

301 amino acids

Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes (By similarity).

Belongs to the RNase HII family. Eukaryotic subfamily.

33.286 kDa

MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFVGWALDILSPNLISTSMLGRVKYNLNSMSHDTAAGLIQHAMDQNVKVTQVFVDTVGMPETYQARLQQRFPGIEVTVKAKADSLFPVVSAASIIAKVARDQAVKNWQFVESLQGLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAESVTWEDSAAEEDPEGPGRITSYFSQGPQACRPQVSHKYFQERGLETATSL

RNASEH2A

Ribonuclease H2 subunit A

299 amino acids

Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.

Belongs to the RNase HII family. Eukaryotic subfamily.

33.3 kDa

MDLSELERDNTGRCRLSSPVPPVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLEDLEALKVADSKTLSESERDRLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNALSHDTATGLVQFALDQGVNVAQVFVDTVGLPETYQERLQQRFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKNWKFVEKLQDLDTDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWRTAQSILESEAEDVKWEDSETGDPKGPGKIKSYFSESPQTCLRLPHRYFQERGLESATVL

RNASEH2A

Ribonuclease H2 subunit A

299 amino acids

Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.

Belongs to the RNase HII family. Eukaryotic subfamily.

33.395 kDa

MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESATSL

rnaseh2A

Ribonuclease H2 subunit A

289 amino acids

Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Participates in DNA replication (By similarity).

Belongs to the RNase HII family. Eukaryotic subfamily.

33.083 kDa

MDNKIIYLTELDSSVDKSEPFVMGIDEAGRGPVMGPMVYGCCYAPISKSTTLKSMKFNDSKKLTEQQRDQLFDKMGESNKILAYETDVITAEILSEKMLYKKPISLNVISHESAIGLIRSVLKKGVNVQELYLDTVGPPDKYQLMLKKLFPEIGKIIVSKKADSLYPIVSAASIAAKVVRDFEITNKNFDYLNIYDQDEQLSTDFGSGYPSDPLSKKWLVKNRDKVFGYPNFIRFSWKTTETAMRGACFGVDWVLENDKLKQHFQENQNDKKRFMFFKENNIENCINDF