RMI2

RecQ-mediated genome instability protein 2

157 amino acids

Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.

Belongs to the RMI2 family.

16.948 kDa

MAAPTDSLSVSGPTAVRLPRSPPIKVLAEQLRRDAEGGPGSWRLSRAAVGREPLELRAVWMQGTVVEAGGGVARLRDPSGSFSVRGLERVPRGRPCLVPGKYVMVMGVIQACSPEPCLQAVKMTDLSDNPLHESLWELEVEDLHRHIYSLDDVGTGD

Rmi2

RecQ-mediated genome instability protein 2

149 amino acids

Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.

Belongs to the RMI2 family.

15.838 kDa

MAAAASESLSSGGPGAVRLPRLPPLKVLAGQLRRHAEGGPGAWRLSRAAVGRAPLELVAVWMQGTVLAAEGGQARLRDSSGAFSVRGLERVPRGRPCLLPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPVHESMWELEVEDLHRNIP

RMI2

RecQ-mediated genome instability protein 2

147 amino acids

Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.

Belongs to the RMI2 family.

15.865 kDa

MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP

RMI2

RecQ-mediated genome instability protein 2

137 amino acids

Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.

Belongs to the RMI2 family.

14.672 kDa

MAGEAASPPLKVLAAQLRAAGRGAGGTWRLSRTETGRAPLCLRAVWMQGTVLQVERGGGGSARLRDGSGHFTVLGVEDVPRGRPCLSAGKYVMVMGMVRACSPEPVLRAIKMTDLSENPVHEEMWGLEVEELHRVIP