About Services Proteins Contact

RHOS4_28450

Gene
RHOS4_28450
Protein
UPF0093 membrane protein RHOS4_28450
Organism
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Length
165 amino acids
Similarity
Belongs to the UPF0093 family.
Mass
19.196 kDa
Sequence
MRMADHFEETTMGTFLADYYLWTKSLHVISVLAWMAGLFYLPRLFVYHAEVVKAGTETDALFQTMERRLLRAIMNPAMIATWIFGLLLVFTPGIVDWSMLWPWTKAACVLAMTGFHMWLAARRRDFAAGANRHKGRTYRMMNELPTLLMLVIVFSAVAKWNYWGF