RAB40B

Ras-related protein Rab-40B

278 amino acids

May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Belongs to the small GTPase superfamily. Rab family.

30.956 kDa

MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS

Rab40b

Ras-related protein Rab-40B

278 amino acids

May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Belongs to the small GTPase superfamily. Rab family.

31.063 kDa

MSSLGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDHKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVVLVYDIANRWSFDGINRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQELCCRAVVSCTPGHLVDKLPLPVALRSHLKSFSMASGLNTRMMHGRSYSLTANSSHKRNSFRKVRTIRPPQSPPRNCARNSCKIS