RAA1

Flowering-promoting factor 1-like protein 1

109 amino acids

GTP-binding protein that functions in the development of root systems, which are mediated by auxin. Acts as a cell cycle regulator during root development. Proteasome-mediated degradation of the protein is necessary for the transition of metaphase to anaphase in mitosis.

Belongs to the FPF1 family.

12.034 kDa

MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVSSYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRDSFRVVDA