About Services Proteins Contact

R02378

Gene
R02378
Protein
Uncharacterized protein R02378
Organism
Rhizobium meliloti (strain 1021)
Length
83 amino acids
Mass
9.676 kDa
Sequence
MALYIKDPTVDRMAEKLQERLGVRTKTDAVRIALQHELDRVEDEIPLREKLAALRQQARDRLGPPVHGIDMKKLMDELWEEGE