QPCT

Glutaminyl-peptide cyclotransferase

368 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

41.99 kDa

MAGERRDSKAAAFFCLAWALCLALPGFPQHVGGREDRADWTQEKYSHRPTILNATSILQVTSQTNVNRMWQNDLHPILIERYPGSPGSYAVRQHIKHRLQGLQAGWLVEEDTFQSHTPYGYRTFSNIISTLNPLAKRHLVVACHYDSKYFLPQLDGKVFVGATDSAVPCAMMLELARSLDRQLSFLKQSSLPPKADLSLKLIFFDGEEAFVRWSPSDSLYGSRSLAQKMASTPHPPGARNTNQIQGIDLFVLLDLIGARNPVFPVYFLNTARWFGRLEAIEQSLHDLGLLNNYSSERQYFRSNIRRYPVEDDHIPFLRRGVPILHLIPSPFPRVWHTMEDNEENLDKPTIDNISKILQVFVLEYLNLG

QPCT

Glutaminyl-peptide cyclotransferase

368 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

41.99 kDa

MAGERRDSKAAAFFCLAWALCLALPGFPQHVGGREDRADWTQEKYSHRPTILNATSILQVTSQTNVNRMWQNDLHPILIERYPGSPGSYAVRQHIKHRLQGLQAGWLVEEDTFQSHTPYGYRTFSNIISTLNPLAKRHLVVACHYDSKYFLPQLDGKVFVGATDSAVPCAMMLELARSLDRQLSFLKQSSLPPKADLSLKLIFFDGEEAFVRWSPSDSLYGSRSLAQKMASTPHPPGARNTNQIQGIDLFVLLDLIGARNPVFPVYFLNTARWFGRLEAIEQSLHDLGLLNNYSSERQYFRSNLRRYPVEDDHIPFLRRGVPILHLIPSPFPRVWHTMEDNEENLDKPTIDNISKILQVFVLEYLNLG

QPCT

Glutaminyl-peptide cyclotransferase

368 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

42.204 kDa

MARERRDSKAATFFCLAWALCLALPGYPQHVSGREDRADWTQEKYSHRPTILNATCILQVTSQTNVSRMWQNDLHPILIERYPGSPGSYAVRQHIKHRLQGLQAGWLVEEDTFQSHTPYGYRTFSNIISTLNPLAKRHLVIACHYDSKYFPPQLDGKVFVGATDSAVPCAMMLELARSLDRPLSFLKQSSLPPKADLSLKLIFFDGEEAFVRWSPSDSLYGSRSLAQKMASTPHPPGARNTYQIRGIDLFVLLDLIGARNPVFPVYFLNTARWFGRLEAIERNLNDLGLLNNYSSERQYFRSNLRRHPVEDDHIPFLRRGVPILHLIPSPFPRVWHTMEDNEENLDKPTIDNLSKILQVFVLEYLNLG

QPCT

Glutaminyl-peptide cyclotransferase

368 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

42.267 kDa

MARERRDSKAATFFCLAWALCLALPGFPQHVSGREDRVDWTQEKYSHRPTILNATCILQVTSQTNVNRMWQNDLHPILIERYPGSPGSYAVRQHIKHRLQGLQAGWLVEEDTFQSHTPYGYRTFSNIISTLNPLAKRHLVIACHYDSKYFPPQLDGKVFVGATDSAVPCAMMLELARSLDRQLSFLKQSSLPPKADLSLKLIFFDGEEAFVRWSPSDSLYGSRSLAQKMASTPHPPGARNTYQIQGIDLFVLLDLIGARNPVFPVYFLNTARWFGRLEAIEQNLYDLGLLNNYSSERQYFRSNLRRHPVEDDHIPFLRRGVPILHLIPSPFPRVWHTMEDNEENLDKPTIDNLSKILQVFVLEYLNLG

Qpct

Glutaminyl-peptide cyclotransferase

362 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

41.119 kDa

MAGSEDKRVVGTLHLLLLQATVLSLTAGNLSLVSAAWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

QPCT

Glutaminyl-peptide cyclotransferase

361 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

41.224 kDa

MAGCRDPRVVDTLHLLLLVAVLPLAVSGVRRGAVDWTQEKNYHQPALLNVSSLRQVAEGTSISEMWQNDLRPLLIERYPGSPGSFAARQHIMQRIQRLQADWVLEVDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFPHWDDRVFVGATDSAVPCAMMLELARALDKQLFSLKNISDSRPDLSLQLIFFDGEEAFHLWSPQDSLYGSRHLASKMASTPHPPGARDTNQLHGMDLLVLLDLIGAPFPTFPNFFPNTARWFGRLEAIEHGLRELGLLKDHSSERWYFRNYGYGGVIQDDHIPFLRRGVPVLHLISSPFPEVWHTMDDNEENLDRTTIDNLNKILQVFVLEYLHL

QPCT

Glutaminyl-peptide cyclotransferase

361 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-amyloid-beta. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.

Belongs to the glutaminyl-peptide cyclotransferase family.

40.877 kDa

MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

qpct

Glutaminyl-peptide cyclotransferase

360 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

42.046 kDa

MKYLKILIIVTIFFFLLINVINCIDRKEIVQKEVKIKFKNLKSTLIKKYSESNMEKIQKHLKHILVERVADTPNHKKVREYIISQFDQLYWDIELDSFKDNTPFGEKTFTNIIVTSKFVNDDDEDDIDTKESNGNISSEPPKTLVLSAHYDSKYFKEFKFFGATDSAVPCSMLIDLAISLQSEIKKSKKKLMIIFFDGEEAFKEWSDTDSLYGSRHLANLLLDKKVITKDNEDLPISSSFYNTVEAFILLDLLGTPNPRFYMFNKKTESLFKKLSDIEDKLSLKRFISPKANKYFQNHFIGSDIQDDHIPFLNYVPTLHIIPYPFPNVWHTEKDDESCLDKNTIEDLSKIFKIFVGSYLI

QPCT

Glutaminyl-peptide cyclotransferase

71 amino acids

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation (By similarity).

Belongs to the glutaminyl-peptide cyclotransferase family.

7.899 kDa

multiple

YPGSPGSYAVRLIFFDGEEAFVRWSPSDSLYGSRMASTPHPPGARHPVEDDHIPFLRGVPILHLIPSPFPR