psmG2

Proteasome assembly chaperone 2

269 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg1.

Belongs to the PSMG2 family.

30.503 kDa

MNKFFYSIDNNNNNISFKNHTLIWPSLTLGNIGQLTIDVLICSFEFKRIGFIVDENITPIIGNDCFTTLDNNNGIMSTSIEVYQSSLFPSITLVQQRSPIVDGRIPNFSENLFKWINAEEIKEILFLSSSNANKRVDSQLTGSQVRFIKSDNVDKNIISKLNEMNISEMELTVQSPEGETIQLSNRLTGLAKEIYSTINSKNNDNNNKVSFLCLNLFCSEGYNTNEALQMSNLIYNFIKNQESPSSPQLKTPSCWKLLQGPTFDQSLFF

Psmg2

Proteasome assembly chaperone 2

264 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG2 family.

29.524 kDa

MFVPCGESVPDLTNFTLLMPAVSVGNVGQLAIDLIISTLNMCKIGYFYTDCLVPMVGNNPYATEEENSNELSINTEVYSLPSKKLVVLQLRSIFIKYKSKSFCEKLLAWVESSGCARIIVLSSSHSYHRNDAQLRSTPFRYLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDAVSLVEYLNEWLQIIKPCNDGPMASALPWKIPSSWRLLFGSGLPPALF

PSMG2

Proteasome assembly chaperone 2

264 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG2 family.

29.224 kDa

MFVPSGDSVPDLAGCTLLMPAVSVGNVGQLAIDLIISTLNMHKIGYFYTDCLVPMVGNNPYATAEENSAELSINAEVYALPSKKLVALQLRSIFIKYKSKSFCEKLLSWVKCSGCAKVVVLSSSHSYHRNDLQLRSTPFRYLLTPSMQKSVQNKIQSLNWEEMEKTPCIPEIDDSEFCVRVPGGGITKLLYDEGCSKEIPIAILLKFVSEGDNIPDALGLVEYLNEWLQIIKPHCEDPTASSLPWKMPSSWRLLFGSGLPPALF

PSMG2

Proteasome assembly chaperone 2

264 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Belongs to the PSMG2 family.

29.396 kDa

MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF

psmg2

Proteasome assembly chaperone 2

261 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg1.

Belongs to the PSMG2 family.

29.128 kDa

MFVPIGSEQDFPSDYTLLLPAISVGNVGQLAIDLIISTLKIPKVGYFYTDCLVPMVGSNPYETDEENAKELCTNAEVYALPSQKLAVLQLRSLVIKKKSKSFRQALVSWIKRCAFARVILLSSCHAYHRDDTQLFGTPFRYLVTPALQKSVADVLKELEWKEMEKVSSYPGLNDNEKRVFIPGGGFTKRFYDDCCLEDLQMAVVLKFCSEGDNVPDAFSLLNQVNEWLHLVASTNGDVLAKWKAPGSWQLLFGSGLPAAIF

psmg2

Proteasome assembly chaperone 2

260 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg1.

Belongs to the PSMG2 family.

28.96 kDa

MFISSGDAVPSFKGFTLILPAVSVGNVGQLAVDLLISTLNMPRVGYFHTDCLIPMAGNNPYASSTEDAAQLSTSAEVYSHRDLKLAVLQIRAPIIQTKVKSFRKLMISWMKSSGFLRTVLLSSAHAYQRDDQQLHGTPLRYMLSPSLEKEERQRFEELGWREMEKISVFPGISDSEQRLYIPGGGVTKCLYTDCCTEDVPMAVVLIFCSEGDNIPDAFALINCLNDWLHLLEKPTQGSVQWRVPPSWKLLFGSGIPPLLF

psmg2

Proteasome assembly chaperone 2

259 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg1.

Belongs to the PSMG2 family.

29.079 kDa

MFVPVGSEQDFPSVSTLLLPAISVGNVGQLAIDLIISTLNIPKVGYFYTDCLVPMVGNNPYETNEENAKELCTNAEVYALPSQKLAVLQLRSLVIKKKSKSFRQALVSWIKRCAFARVIFLSSCHAYHRDDKQLFGTPFRYLVTPALQKSVADVLSELEWKEMEKVSSYPELNDNEKKLFIPGGGFTKAFYNDCCLEDLQMAVVLKFCSEGDNVPDAFSLLNQVNEWLHLVEPTNGDVKWKSPRSWRLLFGSGLPPAIF

psmg2

Proteasome assembly chaperone 2

244 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg1.

Belongs to the PSMG2 family.

27.123 kDa

MFVPCAENVNDLDFSGFTLILPAVSIGNVGQLATDLTISSLSSSRHLIGYLHDASILPVVGNDAFARLGHEKGELNLSAEVYQSTEKRLVIVQQRAPISKGHYANYCQKLLAWIKRCSFKQVVLLSSISATDRVDAQLQGSPLRYMTTSVSQQLSSSFDKLSWVQLEKRPKFPDMTKESDELQFYLPGGGVTKRFFDRCEKEDVPLAVLMTFCSEGDNIADAVSLFLYLNDWLEITNKDTVGVN