About Services Plasmids Contact

Pp1-87B

Gene
Pp1-87B
Protein
Serine/threonine-protein phosphatase alpha-2 isoform
Organism
Drosophila melanogaster
Length
302 amino acids
Function
Is essential for the regulation of mitotic chromosomal segregation as well as regulation of chromatin condensation during interphase.
Similarity
Belongs to the PPP phosphatase family. PP-1 subfamily.
Mass
34.542 kDa
Sequence
MGDVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK