About Services Plasmids Contact

Poxm

Gene
Poxm
Protein
Paired box pox-meso protein
Organism
Drosophila melanogaster
Length
370 amino acids
Mass
38.388 kDa
Sequence
MDPESQCPQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVGVGGMGGMGSTVSPLPMTPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQNGGMHHHHHHGGMMAAGATGL