About Services Plasmids Contact

Porf1

Gene
Porf1
Protein
Putative preoptic regulatory factor 1
Organism
Rattus norvegicus
Length
37 amino acids
Function
Precursor for a gonadotropin regulatory hormone (GNRH) related decapeptide.
Similarity
Belongs to the GnRH family.
Mass
4.142 kDa
Sequence
MPYSLQPQPEGFADVPGFPLCMYMVRGSTWTLVPPDL