Pabp2

Polyadenylate-binding protein 2

225 amino acids

Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation (By similarity).

25.092 kDa

MADEDISLNEDQLLESMEETNGEQETEIVTETEEEGSMQIDPELEAIKARVKEMEEEAEKIKQMQSEVDKQMAGGSTTGLAAVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARASRACCHSTFRGARRAIRGYRGRANYYAPY

Pabp2

Polyadenylate-binding protein 2

224 amino acids

Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product (PubMed:10481015). Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length (By similarity). Increases the affinity of poly(A) polymerase for RNA (By similarity). Binds to poly(A) and to poly(G) with high affinity (PubMed:10481015). May protect the poly(A) tail from degradation (By similarity). Plays a role in the positive regulation of alpha-1,3 fucosylation, possibly by cooperating with swm which regulates nuclear export of fucosyltransferase FucTA (PubMed:21203496).

24.978 kDa

MADEDITLNEDQLLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYRGRANYYAPY