PYM

Protein POLYCHOME

259 amino acids

Negative regulator of the anaphase-promoting complex/cyclosome (APC/C) ubiquitin ligase required for proper mitotic progression and cell fate determination; inhibits premature cell differentiation. Prevents DNA endoreplication by promoting the maintenance of the mitotic state by preferentially inhibiting APC/C(FZR) and triggering cyclins accumulation (e.g. CYCB1-1, CYCB1-2 and CYCA2-3) in a temporal manner. Required for megagametophyte and endosperm development. Counteracts the activity of CCS52A1 thus inhibiting the turnover of CYCA2-3. Confers immunity to bacterial pathogens (e.g. Pseudomonas syringae pv. tomato DC3000), which is associated with increased expression of disease resistance (R) genes.

28.731 kDa

MPEARDRIERQVDYPAAFLNRRSHGILLDEPATQHNLFGSPVQRVPSEATGGLGSIGQGSMTGRGGLVRGNFGIRRTGGGRRGQIQFRSPQGRENMSLGVTRRGRARASNSVLPSWYPRTPLRDISAVVRAIERRRARMGEGVGRDIETPTPQQLGVLDSLVPLSGAHLEHDYSMVTPGPSIGFKRPWPPSTAKVHQILLDITRENTGEEDALTPEKKLLNSIDKVEKVVMEEIQKMKSTPSAKRAEREKRVRTLMSMR

Pym

Partner of Y14 and mago

253 amino acids

Regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation.

Belongs to the pym family.

29.14 kDa

MTTYATDSQGKFIPSTQRPDGTWRKPRRVRDGYVPQEEVPLYESKGKLFAQKPLLPPGMSPEMAQKSREKREREQRIKQQREADANRRPPQNPVPGLLILNGDSKINQPQQRAAKSAKPKKKAVELPDVLLEQKQKEEQKQVRQQQQQQKSQKDHKNTKPHHQERIEEVAKAMNGLQLTNNHVASASAADALQTDLSKKLRKLRKKIREIEIIEERLRSTDGGPRPDKDQIDKAKRKPEILKEIEELEKGIAK

Pym

Partner of Y14 and mago

238 amino acids

Regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation.

Belongs to the pym family.

26.934 kDa

MTTYATDSQGKFIPATQRPDGTWRKPRRVRDGYVPQEEVPLYESKGKLFAQKPSLPPGLPPEMAQKAREKREKEQRKAAARPAQNPVPGLLILHEDNKANQRQAKPANAKPKKKAVELPDVLLEQKQKEEQKAASRQQAQDQRNSKQQQSQNQSKPLDDVTKAVQDLQLGTASGADGHSDLSKKLRKLRKKIREIEVIEERLRASDGPRPDKDQIEKAKRKAEILKEIEELERGGGHK

Pym

Partner of Y14 and mago

233 amino acids

Regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation.

Belongs to the pym family.

25.688 kDa

MTTYSTDSQGKFIPATQRPDGTWRKPRRVRDGYVPQEEVPLYESKGKQFAQKPALPPGLSPEVVQKAKEKRERERLRQAREEQQRKEQQNKKQQAGALPPGVLAVDGGAVGGNNDKQKPGAKQPQQHTKSSQQKSTTAAAAAVSNNSDSTVDELASALASGAQLAGADAQQLEVAKKLRKLRKKIREIEAIETKLRSTDGPKLDKDQLEKVKRKPDILQEIEELEVQYSAGAM

Pym

Partner of Y14 and mago

207 amino acids

Regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor by disrupting mature EJC from spliced mRNAs. Required for normal localization of osk mRNA to the posterior pole of the developing oocyte. Does not interact with the small ribosomal unit or components of the translation initiation complex. May not function in cap-dependent translation regulation.

Belongs to the pym family.

23.45 kDa

MSTYLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPLLAAESKKEREKQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQQPSGSRDINSISKTLEDTLKLDAAQEVVDPAKQLKKLRKKIREIEQIESRIQAGEQKKLDKDQLDKVKKKSEILRQIKDLESTPRS

PYM

Partner of Y14 and mago

204 amino acids

Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs (By similarity). Can increase in vitro the expression from reporter constructs that contain leader introns required for the expression of different genes. In association with MAGO and PYM, participates in intron-mediated enhancement of gene expression (PubMed:21676911).

Belongs to the pym family.

22.588 kDa

MGSRSGEQGKRMAELSKNLKEGERILEPTRRPDGTLRKPIRIRPGYTPEDEVVKYQSKGSLMKKEMASQGPPGYEPDPAPKPKTKAAKRNERKKEKRLQATAEKANSSEDGSASNGSQSVNVLASEMEALDVSSNNDVCGGAPNPGTTGEDVEKRIRALKKKIRLTEAQQQKTASRDLNPEQLEKFSKLEEWRQELKALEDKAA

Pym

Partner of Y14 and mago

204 amino acids

Regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation.

Belongs to the pym family.

23.066 kDa

MSTYLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPLVAAESKKEREKQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQPSGSRDINSISKAMEDTLKLDAPQEVVDPAKQLKKLRKKIREIEQIESRIQAGEQKKLDKDQLDKVKKKSEILRQIKDLESTPRS

Pym

Partner of Y14 and mago

193 amino acids

Regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation.

Belongs to the pym family.

21.858 kDa

MSTPTAYEHDADGSKFIPATQRPDGTWRKPRRIKEGYVPQEEVPLYESKGKQFRARQNDGLPVGLTPEIVAQAQKKKGQRSTIQPIPGMIITVEKKKKKKKTVTGVEEAAEKLAKCEIQEPTLPSQSVPTESISQSDPTKRLKNLRKKLREIEFLEEKIKAGLLKSPDKDQKEKMSKKNEILNEIDILKNSIL