PSMB8

Proteasome subunit beta type-8

276 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides (By similarity). May participate in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (By similarity). Required for adipocyte differentiation (By similarity).

Belongs to the peptidase T1B family.

30.268 kDa

MALLDVCGAPGGQRGDWAVPLAGSRQRSDPGHYGFSLRSPELALPRGMQPTEFFRSLGGNGESKVQIEMAHGTTTLAFKFQHGVIVAVDSRASAGNYIATLKVNKVIEINPYLLGTMSGCAADCLYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDENGTRLSGNMFSTGSGNSHAYGVMDSGYRPDLSIEEAYDLGRRAIVHATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLMHQYREASQ

PSMB8

Proteasome subunit beta type-8

276 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides (By similarity). May participate in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (By similarity). Required for adipocyte differentiation (By similarity).

Belongs to the peptidase T1B family.

30.499 kDa

MALLEVCGAPRGLRKACAVPALGSQLRSDPGHYSFSLRAPELAVPRGMQPTEFFQSLGENGEKNIRKEMVHGTTTLAFKFQHGVIVAVDSRATAGNYISSSRVNKVIEINPSLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMVYQYRGMDLSMGSMICGWDKKGPGLYYVDQNGTRLSGNMFSTGSGSTYAYGVMDSGYQPSLSPEEAYELGRRAITYATHRDSYSGGIINMYHMKEDGWVKVESTDVNELLHQYQEANQ

PSMB8

Proteasome subunit beta type-8

276 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Involved in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (PubMed:27049119). Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.

Belongs to the peptidase T1B family.

30.354 kDa

MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

Psmb8

Proteasome subunit beta type-8

276 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. May participate in the inflammatory response pathway. Required for adipocyte differentiation (PubMed:21881205, PubMed:22341445, PubMed:8066463). May be involved in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (By similarity).

Belongs to the peptidase T1B family.

30.26 kDa

MALLDLCGAARGQRPEWAALDAGSGGRSDPGHYSFSAQAPELALPRGMQPTAFLRSFGGDQERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYATHRDNYSGGVVNMYHMKEDGWVKVESSDVSDLLYKYGEAAL

Psmb8

Proteasome subunit beta type-8

276 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. May participate in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (By similarity). Required for adipocyte differentiation (By similarity).

Belongs to the peptidase T1B family.

30.57 kDa

MALLDLCGAPRGQRPEWAAVDAGSGLRSDPGHYSFSVQAPELALPRGMQPTEFLRSFGDDQERKVQIEMAHGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLARRAIVYATHRDSYSGGVVNMYHMKKDGWVKVESTDVSDLLHKYREATL

PSMB8

Proteasome subunit beta type-8

104 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. May participate in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (By similarity). Required for adipocyte differentiation (By similarity).

Belongs to the peptidase T1B family.

11.604 kDa

single

RLYYLRNGARISVSAASKLXSNMMYQYRGMGLSMGSMICGWDKKGPGLYYVDENGTRLSGNMFSTGSGNTYAYGVMDSGHRYDLSIEEAYDLGRRAIVHATHRD