Psmb11

Proteasome subunit beta type-11

302 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Incorporated instead of PSMB5 or PSMB8, this unit reduces the chymotrypsin-like activity of the proteasome. Plays a pivotal role in development of CD8-positive T-cells.

Belongs to the peptidase T1B family.

33.22 kDa

MALQDVCKWQTPDTPRPSIHLPQAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHQRLLGTTSGTSADCATWYRVLRRELRLRELREGQLPSVAGTAKLLAAMMSCYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDIFSVGSGSPYAYGVLDRGYHYDMTIQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESGWEYVSRSDACVLYRELQKARSLEQELEAKACGIYPEPATPQGARECKELFVEQEEVTPEDCAIIMKTETM

PSMB11

Proteasome subunit beta type-11

300 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Incorporated instead of PSMB5 or PSMB8, this unit reduces the chymotrypsin-like activity of the proteasome (By similarity). Plays a pivotal role in development of CD8-positive T cells (By similarity).

Belongs to the peptidase T1B family.

32.53 kDa

MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV