About Services Plasmids Contact

PP_5201

Gene
PP_5201
Protein
UPF0149 protein PP_5201
Organism
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
184 amino acids
Similarity
Belongs to the UPF0149 family.
Mass
19.468 kDa
Sequence
MPNTQSPYNAFAMLLSSNGHPVTPAELHGLLIGRSCAGAGFDADAWLADAAQLLEIEPGDSVRNALVGLQEMVKGELTSDDMAIVLLLPTDDAALSDRATALGQWCQGFVTGFGLNAGGKDLSDEAKEVLQDLVAISQVQEALEESEDGESDYMEVMEYLRVAPLLLFSELAKPAAPAPKPSLH