About Services Plasmids Contact

PP_4981

Gene
PP_4981
Protein
UPF0312 protein PP_4981
Organism
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
192 amino acids
Similarity
Belongs to the UPF0312 family. Type 1 subfamily.
Mass
20.694 kDa
Sequence
MLKKTFAALALGTALLSAGQAMAAEYKIDKEGQHAFVDWKISHLGYSFIHGTFKDFDGNFSWDSAKPEASKISVDLKTASLWSNHAERDKHIASADFLDVKKYPDAKFVSTSVKSTGDKTADVTGDLTMHGVTKPVTFKATFNGEGKDPWGGERAGFNATTTLNLNDFGIKGPGATSQTLDLDISVEGVKQK