About Services Plasmids Contact

PP_4268

Gene
PP_4268
Protein
Nucleoid-associated protein PP_4268
Organism
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
111 amino acids
Function
Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
Similarity
Belongs to the YbaB/EbfC family.
Mass
12.036 kDa
Sequence
MMKGGMAGLMKQAQQMQEKMQKMQEELANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMSTDEDDKEVLEDLIAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF