About Services Plasmids Contact

PP_2059

Gene
PP_2059
Protein
UPF0337 protein PP_2059
Organism
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
82 amino acids
Similarity
Belongs to the UPF0337 (CsbD) family.
Mass
8.687 kDa
Sequence
MKREQIEGVAEDLAGKAQSAVGRLVEDPALEAEGDARQAAGQVTKTYGDTLDTVSSFVKEKPFAALAITAAVTLVVSRLLRR