About Services Plasmids Contact

PP_0007

Gene
PP_0007
Protein
Putative membrane protein insertion efficiency factor
Organism
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
81 amino acids
Function
Could be involved in insertion of integral membrane proteins into the membrane.
Similarity
Belongs to the UPF0161 family.
Mass
9.214 kDa
Sequence
MRKLALVPIQFYRYAISPLMANHCRFFPSCSCYAYEAIENHGIWRGGWLAVRRLGRCHPWNDGGYDPVPPAPSSRTSSIAE