About Services Plasmids Contact

PPAF2

Gene
PPAF2
Protein
Phenoloxidase-activating factor 2
Organism
Holotrichia diomphalia
Length
415 amino acids
Function
Binds and activates processed prophenoloxidases PPO1 and PPO2 and thus is involved in the activation of the prophenoloxidase cascade probably following the recognition of pathogen-derived products.
Similarity
Belongs to the peptidase S1 family. CLIP subfamily.
Mass
45.258 kDa
Sequence
MKRLFVITAFFLFGAEAQNSVIDAAVVNIFGNASEYIPPGYEIVTKAPLGALTALPRCGTGADQGKKVCIVYHRCDGVTNTVTPEEVINTTGEGIFDIRENANECESYLDVCCGLPEGGVLPTPSPTPPVVPVLKPSFCGIRNERGLDFKITGQTNEAEYGEFPWMVAVLKANVIPGSGEEQLVCGGSLIAPSVVLTGAHCVNSYQSNLDAIKIRAGEWDTLTEKERLPYQERKIRQVIIHSNFNPKTVVNDVALLLLDRPLVQADNIGTICLPQQSQIFDSTECFASGWGKKEFGSRHRYSNILKKIQLPTVDRDKCQADLRNTRLGLKFVLDQTFVCAGGEQGKDTCTGDGGSPLFCPDPRNPSRYMQMGIVAWGIGCGDENVPGVYANVAHFRNWIDQEMQAKGLSTTPYVE