About Services Plasmids Contact

PPA2351

Gene
PPA2351
Protein
Putative membrane protein insertion efficiency factor
Organism
Cutibacterium acnes (strain DSM 16379 / KPA171202)
Length
138 amino acids
Function
Could be involved in insertion of integral membrane proteins into the membrane.
Similarity
Belongs to the UPF0161 family.
Mass
15.726 kDa
Sequence
MRRFRPLTWLAIGFVKGWRALISPLYGDVCKYQPSCSTYGLRALQVHGVFRATPMIIWRILRCNPWSHGGYDPVPGTPEARQWRELHPETARSKNEPIHDLTDDNPRDHEPALRKSIPGYTDPGSTHTGTPSHTRGEN