About Services Plasmids Contact

PPA1896

Gene
PPA1896
Protein
UPF0336 protein PPA1896
Organism
Cutibacterium acnes (strain DSM 16379 / KPA171202)
Length
142 amino acids
Similarity
Belongs to the UPF0336 family.
Mass
15.699 kDa
Sequence
MSISSHDVGRTYPTTDPYLVTAEKIRELATALGDNAPAYRGDDPIAPPTFAMVLASRAWEALFDDEQLDLRLEHMIHTDQSFHWIRPLHEGDEVTAALTITSVRTRGNTDIIGINVSLDHVDGEHLGNATSTLWHTRPEGNA