About Services Plasmids Contact

PP2B8

Gene
PP2B8
Protein
Putative F-box protein PP2-B8
Organism
Arabidopsis thaliana
Length
305 amino acids
Mass
35.239 kDa
Sequence
MTKTRCMHEHFRKIVQRVKKTLRLSASDKSHGVAELDDLPEECVSIIVSFTSPQDACVLASVSKTFASAVKSDIVWEKFIPPEYESLISQSRAFKFLSKKELYFALCDKSVLIDDGKKSLWIEKANAKRCIMISAMNLAIAWGNSPQSWRWIPDPQARFETVAELLEVCLFEIRGRINSRVISPKTRYSAYIVYKKLNICYGFENVAVEVVVGVVGQDLEESCRRYICFDETMDEQFRRRDRGKNLVKPERRKDGWMEIKIGEFFNEGGLLNDDEIEMVALEAKQRHWKRGLIIQGIEIRPTNIR