About Services Plasmids Contact

PP2A9

Gene
PP2A9
Protein
Protein PHLOEM PROTEIN 2-LIKE A9
Organism
Arabidopsis thaliana
Length
180 amino acids
Mass
20.348 kDa
Sequence
MSSQKSSHHKADSKMEQDNNRKAWISQPSGLNFVWGGDSRYWVIPKEPRMPAELKMVSWLEVTGSFDKIEPGKTYRIGFKISFKPDATGWDKAPVFMSAKIGKKGKTVWKRIKSVSQNFGILKGGSEPVNIPDESDGLFEILVSPTALNQDTKLQFGLYEVWTGRWKTGLLIHEAFVQEV