About Services Plasmids Contact

PP2A5

Gene
PP2A5
Protein
Protein PHLOEM PROTEIN 2-LIKE A5
Organism
Arabidopsis thaliana
Length
411 amino acids
Mass
47.963 kDa
Sequence
MSGASSVSSICSSNVSLIPTGPQVFINFRGKDLRKGFMSFLKPALKKEKINVFIDEQEERGKYLISLFDTIGESKIALVIFSEGYCESHWCMDELVKIKEYMDQNRLIIIPIFYRLDLDVVKDLTGKFGDNFWDLVDKYQPEPKKLHKWTEALFSVCELFSLILPKHSDISDRDFVKSIVKAVKKVQKNFFQRRNGEIEYQDFSVPACKLTITMHESPNEEAVQVTVLNEFYQMKNQSPVPSYEFKFWVDLTRPKGNVFMIDARDLSIAWSEDSNHWTWLPLPNQNSNESVMEIAFLKSASWLDVAGKFDTRYLTPRTRYEVVFVVKLEYTFEWETLVKLKLDLPNTWEKPQEQSVDMFDYISDQWLDIPVGEFTTSKKNVGEISFAMYEHECQLWKSGLFVKGVTIRPKY

Gene
PP2A5
Protein
Serine/threonine-protein phosphatase PP2A-5 catalytic subunit
Organism
Arabidopsis thaliana
Length
307 amino acids
Function
Associates with the serine/threonine-protein phosphatase PP2A regulatory subunits A and B' to positively regulates beta-oxidation of fatty acids and protoauxins in peroxisomes by dephosphorylating peroxisomal beta-oxidation-related proteins (PubMed:25489022). Involved in the positive regulation of salt stress responses. May function by increasing chloride channel activities on vacuolar membranes (PubMed:27676158).
Similarity
Belongs to the PPP phosphatase family. PP-2A subfamily.
Mass
35.042 kDa
Sequence
MPPATGDIDRQIEQLMECKALSETEVKMLCEHAKTILVEEYNVQPVKCPVTVCGDIHGQFYDLIELFRIGGSSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHTNGLSLISRAHQLVMEGFNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQVEPETTRKTPDYFL