About Services Plasmids Contact

PP2A15

Gene
PP2A15
Protein
F-box protein PP2-A15
Organism
Arabidopsis thaliana
Length
300 amino acids
Mass
34.197 kDa
Sequence
MGSSLSNLNDGTNGLAMGPGLGDIPESCVACVFMYLTPPEICNLAGLNRSFRGAASSDSVWEKKLPENYQDLLDLLPPERYHSLSKKDIFAVLSRPIPFDDDNKEVWIDRVTGRVCMAISARGMSITGIEDRRYWNWIPTEESRFHVVAYLQQIWWFEVDGTVRFHLPPGVYSLSFRIHLGRFTKRLGRRVCHFELTHGWDLKPVRFSLSTSDGQEASCEYYLDDVERNEALGKHKRGYWIEYRVGEFIVNGSEPSTEIQWSMKQIDCTHSKGGLCVDSVFINPIGDVKEHKRKAVLKEA