About Services Plasmids Contact

POU2F3

Gene
POU2F3
Protein
POU domain, class 2, transcription factor 3
Organism
Homo sapiens
Length
436 amino acids
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Regulated the expression of a number of genes such as SPRR2A or placental lactogen.
Similarity
Belongs to the POU transcription factor family. Class-2 subfamily.
Mass
47.432 kDa
Sequence
MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYLH

Gene
Pou2f3
Protein
POU domain, class 2, transcription factor 3
Organism
Mus musculus
Length
431 amino acids
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3').
Similarity
Belongs to the POU transcription factor family. Class-2 subfamily.
Mass
47.071 kDa
Sequence
MVNLEPMHTEIKMSGDVADSTDTRSTFGQVEPGNDRNGLDFNRQIKTEDLGDSLQQTLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLRSQAVGRPGLSGSSLEPHLDAPQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDPESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSGSWYRWNHPTYLH

Gene
Pou2f3
Protein
POU domain, class 2, transcription factor 3
Organism
Rattus norvegicus
Length
430 amino acids
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Activates cytokeratin 10 (K10) gene expression. May serve a regulatory function with respect to epidermal development. Isoform 2 inhibits transactivation by OCT-1.
Similarity
Belongs to the POU transcription factor family. Class-2 subfamily.
Mass
46.814 kDa
Sequence
MVNLEPMHTEIKMSGDVADSTDARSTFGQVESGNDRNGLDFNRQIKTEDLGDTLHESLSHRPCHLTEGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLTSQAVGRPGLSGSSLEPHLEASQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPADPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGSLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNPSSAAFNSSGSWYRWNHPAYLH

Gene
pou2f3
Protein
POU domain, class 2, transcription factor 3
Organism
Xenopus laevis
Length
111 amino acids
Similarity
Belongs to the POU transcription factor family. Class-2 subfamily.
Mass
12.53 kDa
Fragment
single
Sequence
QGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESAPSDTALTPSANYAQLSEMFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLV