POR1

Protochlorophyllide reductase, chloroplastic

398 amino acids

Phototransformation of protochlorophyllide (Pchlide) to chlorophyllide (Chlide).

Belongs to the short-chain dehydrogenases/reductases (SDR) family. POR subfamily.

43.365 kDa

MALQAASFLPSSFSINKEGKANVSLKETSLFGVTFSDSLRTDFSSLRTRRGCRQISQTGAIRSQAVATTPSVNRATGEGKKTLRKGSVIITGASSGLGLATAKALAETGKWHVIMACRDFLKAERAAKSAGMPKENYTIMHLDLASLDSVRQFVETFRRSERPLDVLVCNAAVYFPTAKEPTYTADGFELSVGTNHLGHFLLSRLLLDDLNKSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLAGGLNGMNSSAMIDGAEFDGAKAYKDSKVCNMLTMQEFHRRYHEETGITFASLYPGCIATTGLFREHIPLFRTLFPPFQKYITKGYVSEAESGKRLAQVVSEPSLTKSGVYWSWNKDSASFENQLSEEASDVEKARKVWEVSEKLVGLA

POR1

Mitochondrial outer membrane protein porin 1

283 amino acids

Forms a channel through the cell membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. Is the major permeability factor of the mitochondrial outer membrane.

Belongs to the eukaryotic mitochondrial porin family.

30.428 kDa

MSPPVYSDISRNINDLLNKDFYHATPAAFDVQTTTANGIKFSLKAKQPVKDGPLSTNVEAKLNDKQTGLGLTQGWSNTNNLQTKLEFANLTPGLKNELITSLTPGVAKSAVLNTTFTQPFFTARGAFDLCLKSPTFVGDLTMAHEGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRYLPDASSQVKAKVSDSGIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSLSFDA

POR1

Mitochondrial outer membrane protein porin

282 amino acids

Forms a channel through the cell membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (By similarity).

Belongs to the eukaryotic mitochondrial porin family.

29.767 kDa

MAPAAYSDLSKASNDLINKDFYHLSTAAVDVKTVAPNGVTFTVKGKTTKDDTISASVDAKYLDKATGLTLTQGWNNANALNTKIELSELLTPGLKGELDTSVVPNGARNAKLNFFYQQSAVNARLFFDLLKGPIATADLVVAHDGFTAGAELGYDISSAKVNKYSVGVGYANLNYGLAATATSNLSVFSAAYFHKVSPLVQVGAKATWDSIKSSNVNVEFATKYALDNTSFIKAKIADSGLTALSYTQELRPGVKLGLGASFDALKLAEPVHKLGFSLSFAA

POR1

Outer plastidial membrane protein porin

277 amino acids

Forms a channel through the cell membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (By similarity).

Belongs to the eukaryotic mitochondrial porin (TC 1.B.8.1) family.

29.977 kDa

MVVAVGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNKKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLKH

POR1

Outer plastidial membrane protein porin

276 amino acids

Forms a channel through the cell membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (By similarity).

Belongs to the eukaryotic mitochondrial porin (TC 1.B.8.1) family.

29.597 kDa

MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQLKNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSSVGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGDLLSASYYHAINPLSNTAVGVDISHRFSTKENTFTLGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKSLITISSEVDTKAIEKSAKIGLSLALKP